Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDK1 Peptide - middle region

PDK1 Peptide - middle region

Product Specifications

Product Name Alternative

B830012B01, D530020C15Rik

UniProt

Q8BFP9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_766253.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QYFLDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPDH2 Mouse Monoclonal Antibody [Clone ID: OTI2F10]
CF810973 100 µg

IMPDH2 Mouse Monoclonal Antibody [Clone ID: OTI2F10]

Sign In for Pricing
View Details
Tnfaip8l2 Mouse Gene Knockout Kit (CRISPR)
KN517971 1 Kit

Tnfaip8l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Qpctl Mouse Gene Knockout Kit (CRISPR)
KN514304 1 Kit

Qpctl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Duodenum
CS708236 5x 5 µm

Tissue FFPE Sections, Duodenum

Sign In for Pricing
View Details
MEF2C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F2]
TA502552AM 100 µL

MEF2C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F2]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708282 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details