Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRM Peptide - middle region

SRM Peptide - middle region

Product Specifications

Product Name Alternative

SpdST, SpdSy, AA407669

UniProt

Q64674

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033298.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGEC

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Centromere protein O (CENPO) ELISA Kit
GTR10356128 96 Well

Bovine Centromere protein O (CENPO) ELISA Kit

Sign In for Pricing
View Details
Putative zinc finger protein 725 (ZNF725) Human ELISA Kit
G5799 96 Tests

Putative zinc finger protein 725 (ZNF725) Human ELISA Kit

Sign In for Pricing
View Details
Rat Chondroitin sulfate synthase 2 (CHPF) ELISA Kit
GTR10322340 96 Well

Rat Chondroitin sulfate synthase 2 (CHPF) ELISA Kit

Sign In for Pricing
View Details
ITGB1 (Phospho-T789) Blocking Peptide
orb392789-01 1 mg

ITGB1 (Phospho-T789) Blocking Peptide

Sign In for Pricing
View Details
ITGB1 (Phospho-T789) Blocking Peptide
orb392789-02 5 mg

ITGB1 (Phospho-T789) Blocking Peptide

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon
CD564615 5 µg

Tissue Genomic DNA, Colon

Sign In for Pricing
View Details