Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRM Peptide - middle region

SRM Peptide - middle region

Product Specifications

Product Name Alternative

SpdST, SpdSy, AA407669

UniProt

Q64674

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033298.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGEC

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCMF1 shRNA Plasmid (m)
sc-146355-SH 20 µg

KCMF1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Taurodeoxycholate sodium salt 10mM * 1mL in DMSO
A18577-10mM-D 10 mM x 1mL in DMSO

Taurodeoxycholate sodium salt 10mM * 1mL in DMSO

Sign In for Pricing
View Details
CAMK1D Polyclonal Antibody
MBS2521918-01 0.02 mL

CAMK1D Polyclonal Antibody

Sign In for Pricing
View Details
CAMK1D Polyclonal Antibody
MBS2521918-02 0.06 mL

CAMK1D Polyclonal Antibody

Sign In for Pricing
View Details
CAMK1D Polyclonal Antibody
MBS2521918-03 0.12 mL

CAMK1D Polyclonal Antibody

Sign In for Pricing
View Details
CAMK1D Polyclonal Antibody
MBS2521918-04 0.2 mL

CAMK1D Polyclonal Antibody

Sign In for Pricing
View Details