Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3 Peptide - middle region

APOBEC3 Peptide - middle region

Product Specifications

Product Name Alternative

Arp3, Rfv3, Cem15, Apobec, Gm20117, BC003314

UniProt

Q99J72

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQVAAMDLYEFKKCWKKFVDNGGRRFRPWKRLLTNFRYQDSKLQEILRPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A/G Affinity Agarose
EA-IP-007 2 mL

Protein A/G Affinity Agarose

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF568 conjugate, 0.1mg/mL
BNC682332-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L2 / PDCD1LG2 / CD273 (PDL2/1850), CF640R conjugate, 0.1mg/mL
BNC401850-500 1x 500 µL

PD-L2 / PDCD1LG2 / CD273 (PDL2/1850), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF640R conjugate, 0.1mg/mL
BNC402752-100 1x 100 µL

Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trypsin Activity Assay Kit
E-BC-K843-M-01 48 T (32 samples)

Trypsin Activity Assay Kit

Sign In for Pricing
View Details
Trypsin Activity Assay Kit
E-BC-K843-M-02 96 T (80 samples)

Trypsin Activity Assay Kit

Sign In for Pricing
View Details