Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3 Peptide - middle region

APOBEC3 Peptide - middle region

Product Specifications

Product Name Alternative

Arp3, Rfv3, Cem15, Apobec, Gm20117, BC003314

UniProt

Q99J72

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQVAAMDLYEFKKCWKKFVDNGGRRFRPWKRLLTNFRYQDSKLQEILRPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,4-Dibutyl Benzene-1,4-dicarboxylate
TRC-D159391-100MG 100 mg

1,4-Dibutyl Benzene-1,4-dicarboxylate

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (A522V) (His Tag)
PKSV030415 100 µg

Recombinant SARS-CoV-2 Spike RBD (A522V) (His Tag)

Sign In for Pricing
View Details
D-Histidine
TRC-H456015-25G 25 g

D-Histidine

Sign In for Pricing
View Details
Calcium Lactate Pentahydrate
TRC-C145615-10G 10 g

Calcium Lactate Pentahydrate

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF488A conjugate, 0.1mg/mL
BNC880718-100 1x 100 µL

HER-2 / CD340 (HRB2/718), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF640R conjugate, 0.1mg/mL
BNC401149-100 1x 100 µL

CD71 (TFRC/1149), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details