Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOD1 Peptide - middle region

ACOD1 Peptide - middle region

Product Specifications

Product Name Alternative

CAD, Irg1, AI323667

UniProt

Q9D8I5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032418.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPDNPPSFDTLYCEISITLKDGTTFTERSDTFYGHWRKPLSQEDLRNKFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Clarin-3 (Clrn3)
orb2917729-01 20 µg

Recombinant Mouse Clarin-3 (Clrn3)

Sign In for Pricing
View Details
Recombinant Mouse Clarin-3 (Clrn3)
orb2917729-02 100 µg

Recombinant Mouse Clarin-3 (Clrn3)

Sign In for Pricing
View Details
Golgi Complex (HRP)
172100-AF-HRP 100 µL

Golgi Complex (HRP)

Sign In for Pricing
View Details
NOS2 Rabbit Polyclonal Antibody
orb585494 100 µL

NOS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rigose CM
MBS8579664-01 25 mL

Rigose CM

Sign In for Pricing
View Details
Rigose CM
MBS8579664-02 100 mL

Rigose CM

Sign In for Pricing
View Details