Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOD1 Peptide - middle region

ACOD1 Peptide - middle region

Product Specifications

Product Name Alternative

CAD, Irg1, AI323667

UniProt

Q9D8I5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032418.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPDNPPSFDTLYCEISITLKDGTTFTERSDTFYGHWRKPLSQEDLRNKFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Variable Speed Peristaltic Pump
51-VPP300 1 Unit

Variable Speed Peristaltic Pump

Sign In for Pricing
View Details
Lentiviral mouse R3hdm2 shRNA (UAS) - Lentiviral mouse R3hdm2 shRNA (UAS, RFP) (100)
GTR15243012 1 Vial

Lentiviral mouse R3hdm2 shRNA (UAS) - Lentiviral mouse R3hdm2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
MCPH1 Antibody
MBS8515534-01 0.1 mg

MCPH1 Antibody

Sign In for Pricing
View Details
MCPH1 Antibody
MBS8515534-02 0.1 mL (AF635)

MCPH1 Antibody

Sign In for Pricing
View Details
MCPH1 Antibody
MBS8515534-03 0.1 mL (AF610)

MCPH1 Antibody

Sign In for Pricing
View Details
MCPH1 Antibody
MBS8515534-04 0.1 mL (AF405S)

MCPH1 Antibody

Sign In for Pricing
View Details