Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT4 Peptide - middle region

SYT4 Peptide - middle region

Product Specifications

Product Name Alternative

SytIV

UniProt

P50232

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033334.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Senescence Marker Antibody Sampler Kit
HAK21082 1 Kit

Senescence Marker Antibody Sampler Kit

Sign In for Pricing
View Details
Benfluorex Hydrochloride
TRC-B135000-25MG 25 mg

Benfluorex Hydrochloride

Sign In for Pricing
View Details
ACVR2A Mouse Monoclonal Antibody [A7C8]
HA601091 100 µL

ACVR2A Mouse Monoclonal Antibody [A7C8]

Sign In for Pricing
View Details
CD163 Polyclonal Antibody
E-AB-70306-01 60 µL

CD163 Polyclonal Antibody

Sign In for Pricing
View Details
CD163 Polyclonal Antibody
E-AB-70306-02 120 µL

CD163 Polyclonal Antibody

Sign In for Pricing
View Details
CD163 Polyclonal Antibody
E-AB-70306-03 200 µL

CD163 Polyclonal Antibody

Sign In for Pricing
View Details