Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT4 Peptide - middle region

SYT4 Peptide - middle region

Product Specifications

Product Name Alternative

SytIV

UniProt

P50232

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033334.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHR1 (PLEKHB1) Human Gene Knockout Kit (CRISPR)
KN416627 1 Kit

PHR1 (PLEKHB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cadherin like 26 (CDH26) (NM_177980) Human Recombinant Protein
TP314867 20 µg

Cadherin like 26 (CDH26) (NM_177980) Human Recombinant Protein

Sign In for Pricing
View Details
Formestane
TRC-F692250-50MG 50 mg

Formestane

Sign In for Pricing
View Details
Freeze Dryer BFFT-303-B
BFFT-303-B 1 Unit

Freeze Dryer BFFT-303-B

Sign In for Pricing
View Details
2,2-Bis[4-[2-(diethylamino)ethoxy]phenyl]-1,2-diphenylethanone Dihydrochloride
TRC-B426250-25MG 25 mg

2,2-Bis[4-[2-(diethylamino)ethoxy]phenyl]-1,2-diphenylethanone Dihydrochloride

Sign In for Pricing
View Details
1-(6-Amino-9H-purin-2-yl)-1H-pyrazole-4-carboxylic Acid Ethyl Ester
TRC-A919953-5MG 5 mg

1-(6-Amino-9H-purin-2-yl)-1H-pyrazole-4-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details