What is the catalog number for ALOX12B Peptide - C-terminal region?

The catalog number for ALOX12B Peptide - C-terminal region is orb1998236.

What sizes are available for ALOX12B Peptide - C-terminal region?

ALOX12B Peptide - C-terminal region is available in the following size(s): 100 µg.

Is ALOX12B Peptide - C-terminal region in stock?

ALOX12B Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

ALOX12B Peptide - C-terminal region

Product Specifications

Product Name Alternative

Aloxe2, e-LOX2, 12R-LOX

UniProt

O70582

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033789.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRRPLGHFPDIHFVEEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-18458IR 0.1 mL

Rabbit Polyclonal PBDC1 Antibody [DyLight 755]

Sign In for Pricing

View Details

abx903312-01 15 nmol

Human MPP7 siRNA

Sign In for Pricing

View Details

abx903312-02 30 nmol

Human MPP7 siRNA

Sign In for Pricing

View Details

32227-05111 150 µg

Human Cystatin-11 (CST11) Antibody

Sign In for Pricing

View Details

MBS086788-01 48 Well

Monkey Scavenger Receptor Class B Member 1 ELISA Kit

Sign In for Pricing

View Details

MBS086788-02 96 Well

Monkey Scavenger Receptor Class B Member 1 ELISA Kit

Sign In for Pricing

View Details