Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALOX12B Peptide - C-terminal region

ALOX12B Peptide - C-terminal region

Product Specifications

Product Name Alternative

Aloxe2, e-LOX2, 12R-LOX

UniProt

O70582

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033789.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRRPLGHFPDIHFVEEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IgA Rabbit Monoclonal Antibody
MBS1750097-01 0.03 mL

Anti-IgA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-IgA Rabbit Monoclonal Antibody
MBS1750097-02 0.1 mL

Anti-IgA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-IgA Rabbit Monoclonal Antibody
MBS1750097-03 5x 0.1 mL

Anti-IgA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NTN1 Peptide
42-733P 0.1 mg

NTN1 Peptide

Sign In for Pricing
View Details
Alexa Fluor® 488 anti-mouse CD309 (VEGFR2, Flk-1)
GT04088 25 µg

Alexa Fluor® 488 anti-mouse CD309 (VEGFR2, Flk-1)

Sign In for Pricing
View Details
BT474/RFP-luciferase stable cell line
GTR15423101 1 Vial

BT474/RFP-luciferase stable cell line

Sign In for Pricing
View Details