Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP39A1 Peptide - middle region

CYP39A1 Peptide - middle region

Product Specifications

Product Name Alternative

Mcyp39a1

UniProt

Q9JKJ9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061375.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGVITRKVVKPVKILNHTVPSGDLLMLSPFWLHRNPKYFPEPESFKPERW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tmprss3 activation kit by CRISPRa
GA212534 1 Kit

Mouse Tmprss3 activation kit by CRISPRa

Sign In for Pricing
View Details
Box of 100 PES membranes 0.22 µm, 47 mm
MF047PE022 Box of 100

Box of 100 PES membranes 0.22 µm, 47 mm

Sign In for Pricing
View Details
rno-miR-34c Primers
MP-r00075 150 µL - 10 µM

rno-miR-34c Primers

Sign In for Pricing
View Details
Recombinant Human ADA Protein
E30P1635 20 µg

Recombinant Human ADA Protein

Sign In for Pricing
View Details
3-Amino-4-pyridazinecarboxylic acid
423802-01 25 mg

3-Amino-4-pyridazinecarboxylic acid

Sign In for Pricing
View Details
3-Amino-4-pyridazinecarboxylic acid
423802-02 50 mg

3-Amino-4-pyridazinecarboxylic acid

Sign In for Pricing
View Details