What is the catalog number for CYP39A1 Peptide - middle region?

The catalog number for CYP39A1 Peptide - middle region is orb1998235.

What sizes are available for CYP39A1 Peptide - middle region?

CYP39A1 Peptide - middle region is available in the following size(s): 100 µg.

Is CYP39A1 Peptide - middle region in stock?

CYP39A1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CYP39A1 Peptide - middle region

Product Specifications

Product Name Alternative

Mcyp39a1

UniProt

Q9JKJ9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061375.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGVITRKVVKPVKILNHTVPSGDLLMLSPFWLHRNPKYFPEPESFKPERW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS3205139-01 0.1 mL

SERBP1 antibody - middle region

Sign In for Pricing

View Details

MBS3205139-02 5x 0.1 mL

SERBP1 antibody - middle region

Sign In for Pricing

View Details

MAB1315-SP 25 µg

Mouse Nodal MAb (Clone 209009)

Sign In for Pricing

View Details

EKU12181 96 Tests

Rat Alpha-1-Antitrypsin (a1AT) Mini sample ELISA Kit

Sign In for Pricing

View Details

11935081 1.0 µg

ANKRD13D 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing

View Details

KN516724 1 Kit

Srp72 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing

View Details