What is the catalog number for CREB3L3 Peptide - middle region?

The catalog number for CREB3L3 Peptide - middle region is orb1998232.

What sizes are available for CREB3L3 Peptide - middle region?

CREB3L3 Peptide - middle region is available in the following size(s): 100 µg.

Is CREB3L3 Peptide - middle region in stock?

CREB3L3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CREB3L3 Peptide - middle region

Product Specifications

Product Name Alternative

CREB-H, BC010786, D10Bur1e

UniProt

Q91XE9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_663340.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEKKLLAKEGVTLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb1449466 500 µg

TOR1AIP2 Antibody Blocking peptide

Sign In for Pricing

View Details

enz-782 5µg

TIMP2

Sign In for Pricing

View Details

OKEI00133 96 Well

AKAP1 ELISA Kit (Human) (OKEI00133)

Sign In for Pricing

View Details

TA360992 100 µL

Membralin (TMEM259) Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

283538-01 500 mg

4'-Methoxy-[1,1'-biphenyl]-3-carbaldehyde

Sign In for Pricing

View Details

283538-02 1 g

4'-Methoxy-[1,1'-biphenyl]-3-carbaldehyde

Sign In for Pricing

View Details