Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREB3L3 Peptide - middle region

CREB3L3 Peptide - middle region

Product Specifications

Product Name Alternative

CREB-H, BC010786, D10Bur1e

UniProt

Q91XE9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_663340.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEKKLLAKEGVTLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bafetinib
BA2759-10 10 mg

Bafetinib

Sign In for Pricing
View Details
E2F-5 Polyclonal Antibody
UB-GEN-1633 100 µL

E2F-5 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4G3 Polyclonal Antibody
MBS8569314-01 0.1 mL

EIF4G3 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4G3 Polyclonal Antibody
MBS8569314-02 0.1 mL (AF405L)

EIF4G3 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4G3 Polyclonal Antibody
MBS8569314-03 0.1 mL (AF405S)

EIF4G3 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4G3 Polyclonal Antibody
MBS8569314-04 0.1 mL (AF610)

EIF4G3 Polyclonal Antibody

Sign In for Pricing
View Details