Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA3G Peptide - middle region

SERPINA3G Peptide - middle region

Product Specifications

Product Name Alternative

2A2, spi2, Spi2A, Spi2-1, AI119734, Spi2/eb.1

UniProt

Q5I2A0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033277.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKWKNPFDPNDTFKSEFYLDEKRSVIVSMMKTGYLTTPYFRDEELSCTVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EVER2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2527770 100 µL

EVER2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Alox5 (NM_009662) Mouse Tagged ORF Clone
MR227106 10 µg

Alox5 (NM_009662) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IL15 (Interleukin 15, Interleukin-15, IL-15, MGC9721) (PE)
128397-PE 100 µL

IL15 (Interleukin 15, Interleukin-15, IL-15, MGC9721) (PE)

Sign In for Pricing
View Details
EN2 Engrailed 2 Antibody FITC Conjugated
orb1543211 100 µL

EN2 Engrailed 2 Antibody FITC Conjugated

Sign In for Pricing
View Details
PLK1S1 AAV siRNA Pooled Vector
37017161 1.0 µg

PLK1S1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CD33 Antibody
orb1533409 50 µg

CD33 Antibody

Sign In for Pricing
View Details