What is the catalog number for SERPINA3G Peptide - middle region?

The catalog number for SERPINA3G Peptide - middle region is orb1998230.

What sizes are available for SERPINA3G Peptide - middle region?

SERPINA3G Peptide - middle region is available in the following size(s): 100 µg.

Is SERPINA3G Peptide - middle region in stock?

SERPINA3G Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SERPINA3G Peptide - middle region

Product Specifications

Product Name Alternative

2A2, spi2, Spi2A, Spi2-1, AI119734, Spi2/eb.1

UniProt

Q5I2A0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033277.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKWKNPFDPNDTFKSEFYLDEKRSVIVSMMKTGYLTTPYFRDEELSCTVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

abx323495-01 50 µg

C-C Chemokine Receptor Type 2 (CCR2) Antibody

Sign In for Pricing

View Details

abx323495-02 100 µg

C-C Chemokine Receptor Type 2 (CCR2) Antibody

Sign In for Pricing

View Details

12929086 1.0 µg

B3galt5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing

View Details

45886034 100 µg

SUN3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing

View Details

RC200425L2V 200 µL

RPL14 (NM_003973) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing

View Details

NBP3-24300AF700 0.1 mL

Mouse Monoclonal SBSN Antibody (SBSN/7961) [Alexa Fluor 700]

Sign In for Pricing

View Details