SERPINA3G Peptide - middle region
SERPINA3G Peptide - middle region
Product Specifications
Product Name Alternative
2A2, spi2, Spi2A, Spi2-1, AI119734, Spi2/eb.1
UniProt
Q5I2A0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_033277.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GKWKNPFDPNDTFKSEFYLDEKRSVIVSMMKTGYLTTPYFRDEELSCTVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV721132 1.0 µg DNA
CHEK2P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
34753126 3x 1.0µg DNA
Olr868 CRISPRa sgRNA lentivector (set of three targets)(Rat)
Sign In for Pricing
View Details sc-348235A 1 g
4- (chloroacetyl) -3-phenyl-3,4-dihydro-2H-1,4-benzothiazine
Sign In for Pricing
View Details MBS718126 Inquire
Recombinant Rat Transmembrane protein 194B (Tmem194b)
Sign In for Pricing
View Details S5510-35-APC 200 µL
SPINK5, NT (Serine Protease Inhibitor Kazal-type 5, Lympho-epithelial Kazal-type-related Inhibitor, LEKTI, Hemofiltrate Peptide HF6478, Hemofiltrate Peptide HF7665) (APC) discontinued
Sign In for Pricing
View Details