Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WHRN Peptide - middle region

WHRN Peptide - middle region

Product Specifications

Product Name Alternative

Wi, Ush2d, Dfnb31, AW122018, AW742671, 1110035G07Rik, C430046P22Rik

UniProt

Q80VW5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008791.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVSSARER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCHR2 Over-expression Lysate Product
GWB-E7FE70 0.1 mg

MCHR2 Over-expression Lysate Product

Sign In for Pricing
View Details
UBXN8 Human qPCR Template Standard (BC020694)
HK200442 1 Kit

UBXN8 Human qPCR Template Standard (BC020694)

Sign In for Pricing
View Details
PAAV-CamKII-Pdk1 (mouse) -2xHA
BZ59325 1 Vial

PAAV-CamKII-Pdk1 (mouse) -2xHA

Sign In for Pricing
View Details
TMBIM1 Antibody
MBS7131678-01 0.1 mL

TMBIM1 Antibody

Sign In for Pricing
View Details
TMBIM1 Antibody
MBS7131678-02 5x 0.1 mL

TMBIM1 Antibody

Sign In for Pricing
View Details
Cav2.1 Antibody
E38QA9620 100 µL

Cav2.1 Antibody

Sign In for Pricing
View Details