Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1B8 Peptide - middle region

AKR1B8 Peptide - middle region

Product Specifications

Product Name Alternative

FR-1, Fgrp, Fgfrp

UniProt

P45377

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032038.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNH2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV678993 1.0 µg DNA

KCNH2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Gm4305 Mouse Gene Knockout Kit (CRISPR)
KN506839 1 Kit

Gm4305 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-EPH A3+A4+A5 (Tyr779) Rabbit pAb, Pacific Blue conjugated
orb2859537 100 µL

Phospho-EPH A3+A4+A5 (Tyr779) Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
TECR Antibody
A42963-100UG 100 µg

TECR Antibody

Sign In for Pricing
View Details
Rabbit anti-CD13 Antibody
MBS4505549-01 0.05 mL

Rabbit anti-CD13 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD13 Antibody
MBS4505549-02 0.1 mL

Rabbit anti-CD13 Antibody

Sign In for Pricing
View Details