Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1B8 Peptide - middle region

AKR1B8 Peptide - middle region

Product Specifications

Product Name Alternative

FR-1, Fgrp, Fgfrp

UniProt

P45377

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032038.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse antibody GRP78 ELISA Kit
SL0665Mo-01 48 Tests

Mouse antibody GRP78 ELISA Kit

Sign In for Pricing
View Details
Mouse antibody GRP78 ELISA Kit
SL0665Mo-02 96 Tests

Mouse antibody GRP78 ELISA Kit

Sign In for Pricing
View Details
Rabbit Eukaryotic Translation Initiation Factor 4 Gamma 1 (EIF4G1) ELISA Kit
MBS9358600 Inquire

Rabbit Eukaryotic Translation Initiation Factor 4 Gamma 1 (EIF4G1) ELISA Kit

Sign In for Pricing
View Details
TL4-12
BA2990-25 25 mg

TL4-12

Sign In for Pricing
View Details
FTLP17 3'UTR Lenti-reporter-Luc Vector
21038081 1.0 µg

FTLP17 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CROT Antibody
19-469 100 µL

CROT Antibody

Sign In for Pricing
View Details