SERPINB1A Peptide - middle region
SERPINB1A Peptide - middle region
Product Specifications
Product Name Alternative
EI, EIA, LEI, PI2, MNEI, M/NEI, ELANH2, AI325983, 1190005M04Rik
UniProt
Q9D154
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_079705.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YGADLAPVDFLHASEDARKEINQWVKGQTEGKIPELLSVGVVDSMTKLVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E45H37809M5 20 µg
CRMP2 (DPYSL2) (NM_001386) Human Recombinant Protein
Sign In for Pricing
View Details 
11871061 1.0 µg DNA
AMZ2P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
RC200644L1V 200 µL
EXT1 (NM_000127) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 20931061 1.0 µg DNA
FRAXA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details M00179-1-Fluoro488 100 µg/Vial
Anti-Caveolin-1/CAV1 Antibody Picoband® (monoclonal, 12C7) Fluoro488 Conjugated
Sign In for Pricing
View Details