Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB1A Peptide - middle region

SERPINB1A Peptide - middle region

Product Specifications

Product Name Alternative

EI, EIA, LEI, PI2, MNEI, M/NEI, ELANH2, AI325983, 1190005M04Rik

UniProt

Q9D154

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079705.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGADLAPVDFLHASEDARKEINQWVKGQTEGKIPELLSVGVVDSMTKLVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 discontinued
390177 200 µL

HSP27 discontinued

Sign In for Pricing
View Details
Recombinant CLTC Antibody
RC-5660-01 50 μL

Recombinant CLTC Antibody

Sign In for Pricing
View Details
Recombinant CLTC Antibody
RC-5660-02 100 µL

Recombinant CLTC Antibody

Sign In for Pricing
View Details
Recombinant CLTC Antibody
RC-5660-03 1 mL

Recombinant CLTC Antibody

Sign In for Pricing
View Details
4930433I11Rik 3'UTR Lenti-reporter-Luc Vector
10619084 1.0 µg

4930433I11Rik 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Human alpha-Fetoprotein/AFP Protein
NBP2-52171-0.25mg 0.25 mg

Recombinant Human alpha-Fetoprotein/AFP Protein

Sign In for Pricing
View Details