What is the catalog number for CYP2J5 Peptide - middle region?

The catalog number for CYP2J5 Peptide - middle region is orb1998226.

What sizes are available for CYP2J5 Peptide - middle region?

CYP2J5 Peptide - middle region is available in the following size(s): 100 µg.

Is CYP2J5 Peptide - middle region in stock?

CYP2J5 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CYP2J5 Peptide - middle region

Product Specifications

UniProt

O54749

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034137.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPHQKIFRNWGKLKLFVSHIVKKHEKDWNPDEPRDFIDAFLIEMQKDPDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-06512JF549 0.1 mL

Mouse Monoclonal MOB4A/MOBKL1B Antibody (01) [Janelia Fluor 549]

Sign In for Pricing

View Details

MBS5812336 Inquire

Fandosentan

Sign In for Pricing

View Details

CEK2778 96 Tests

Human Apolipoprotein F ELISA Kit

Sign In for Pricing

View Details

sc-515455 200 µg/mL

CEP104 (C-10)

Sign In for Pricing

View Details

orb1366739 20 µg

CALML3 Human Over-expression Lysate

Sign In for Pricing

View Details

HY-R03620-01 5 nmol

Mmu-miR-6947-5p mimic

Sign In for Pricing

View Details