Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2J5 Peptide - middle region

CYP2J5 Peptide - middle region

Product Specifications

UniProt

O54749

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034137.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPHQKIFRNWGKLKLFVSHIVKKHEKDWNPDEPRDFIDAFLIEMQKDPDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF21A, ID (PHF21A, BHC80, KIAA1696, PHD finger protein 21A, BHC80a, BRAF35-HDAC complex protein BHC80) (Azide free) (HRP)
MBS6333358-01 0.2 mL

PHF21A, ID (PHF21A, BHC80, KIAA1696, PHD finger protein 21A, BHC80a, BRAF35-HDAC complex protein BHC80) (Azide free) (HRP)

Sign In for Pricing
View Details
PHF21A, ID (PHF21A, BHC80, KIAA1696, PHD finger protein 21A, BHC80a, BRAF35-HDAC complex protein BHC80) (Azide free) (HRP)
MBS6333358-02 5x 0.2 mL

PHF21A, ID (PHF21A, BHC80, KIAA1696, PHD finger protein 21A, BHC80a, BRAF35-HDAC complex protein BHC80) (Azide free) (HRP)

Sign In for Pricing
View Details
Recombinant Influenza A virus Hemagglutinin (HA), partial
orb1096079-01 20 µg

Recombinant Influenza A virus Hemagglutinin (HA), partial

Sign In for Pricing
View Details
Recombinant Influenza A virus Hemagglutinin (HA), partial
orb1096079-02 100 µg

Recombinant Influenza A virus Hemagglutinin (HA), partial

Sign In for Pricing
View Details
Recombinant Influenza A virus Hemagglutinin (HA), partial
orb1096079-03 1 mg

Recombinant Influenza A virus Hemagglutinin (HA), partial

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae rmlA Protein (aa 1-288)
VAng-Wyb2322-50gEcoli 50 µg (E. coli)

Recombinant Neisseria Gonorrhoeae rmlA Protein (aa 1-288)

Sign In for Pricing
View Details