What is the catalog number for GTPBP3 Peptide - middle region?

The catalog number for GTPBP3 Peptide - middle region is orb1998224.

What sizes are available for GTPBP3 Peptide - middle region?

GTPBP3 Peptide - middle region is available in the following size(s): 100 µg.

Is GTPBP3 Peptide - middle region in stock?

GTPBP3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GTPBP3 Peptide - middle region

Product Specifications

Product Name Alternative

AI607903, 2410009F13Rik

UniProt

Q923K4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_115933.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QALRQLDGELSQLCQGWAKTLTKALAYVEAYIDFGEDDNLEEGVLEQADR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-59601AF532 0.1 mL

Mouse Monoclonal Creatine Kinase BB Antibody (2ba6) [Alexa Fluor 532]

Sign In for Pricing

View Details

abx010526 100 µL

TNF Receptor Superfamily Member 5 / TNFRSF5 (CD40) Antibody

Sign In for Pricing

View Details

HY-W011094R-01 5 mg

Win 18446 (Standard)

Sign In for Pricing

View Details

HY-W011094R-02 10 mg

Win 18446 (Standard)

Sign In for Pricing

View Details

HY-W011094R-03 25 mg

Win 18446 (Standard)

Sign In for Pricing

View Details

HY-W011094R-04 50 mg

Win 18446 (Standard)

Sign In for Pricing

View Details