Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTPBP3 Peptide - middle region

GTPBP3 Peptide - middle region

Product Specifications

Product Name Alternative

AI607903, 2410009F13Rik

UniProt

Q923K4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_115933.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QALRQLDGELSQLCQGWAKTLTKALAYVEAYIDFGEDDNLEEGVLEQADR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human RUSC1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 120UL
IRBAHURUSC1AAP51120UL 120 µL

Rabbit Anti Human RUSC1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 120UL

Sign In for Pricing
View Details
Lysozyme (10mg/mL)
IBS-BL004 10 mL

Lysozyme (10mg/mL)

Sign In for Pricing
View Details
DDX4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV659670 1.0 µg DNA

DDX4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-Vitamin D Binding Protein Rabbit Monoclonal Antibody
MA5673-.05 50 µL

Anti-Vitamin D Binding Protein Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TAS2R38 (Taste receptor type 2 member 38) BioAssayTM ELISA Kit (Human) discontinued
359140-01 48 Tests

TAS2R38 (Taste receptor type 2 member 38) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
TAS2R38 (Taste receptor type 2 member 38) BioAssayTM ELISA Kit (Human) discontinued
359140-02 96 Tests

TAS2R38 (Taste receptor type 2 member 38) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details