Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTXR Peptide - middle region

NPTXR Peptide - middle region

Product Specifications

Product Name Alternative

NPR, Npcd, AI452369, AI785356, D15Bwg0580e, 1200009K17Rik, 1700036C17Rik, 5730406O18Rik

UniProt

Q99J85

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAQLPLSLKDSNWHHICISWTTRDGLWSAYQDGELRGSGENLAAWHPIKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (ITGAL) Rabbit Monoclonal Antibody [Clone ID: MHM24]
TA386277 200 µg

CD11a (ITGAL) Rabbit Monoclonal Antibody [Clone ID: MHM24]

Sign In for Pricing
View Details
Recombinant GOT1 Antibody
RC-4153-01 50 μL

Recombinant GOT1 Antibody

Sign In for Pricing
View Details
Recombinant GOT1 Antibody
RC-4153-02 100 µL

Recombinant GOT1 Antibody

Sign In for Pricing
View Details
Recombinant GOT1 Antibody
RC-4153-03 1 mL

Recombinant GOT1 Antibody

Sign In for Pricing
View Details
NFS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]
TA805491AM 100 µL

NFS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]

Sign In for Pricing
View Details
Tyrosol
TRC-T947800-5G 5 g

Tyrosol

Sign In for Pricing
View Details