Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTXR Peptide - middle region

NPTXR Peptide - middle region

Product Specifications

Product Name Alternative

NPR, Npcd, AI452369, AI785356, D15Bwg0580e, 1200009K17Rik, 1700036C17Rik, 5730406O18Rik

UniProt

Q99J85

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAQLPLSLKDSNWHHICISWTTRDGLWSAYQDGELRGSGENLAAWHPIKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF39 Human Gene Knockout Kit (CRISPR)
KN416446 1 Kit

RNF39 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Nitrosodiphenyl-2,2',4,4',6,6'-d6-amine
TRC-N525776-2MG 2 mg

N-Nitrosodiphenyl-2,2',4,4',6,6'-d6-amine

Sign In for Pricing
View Details
FAM107B (NM_001282699) Human Tagged ORF Clone
RG235908 10 µg

FAM107B (NM_001282699) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF594 conjugate, 0.1mg/mL
BNC940969-100 1x 100 µL

Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fosthiazate
TRC-F745800-50MG 50 mg

Fosthiazate

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS806764 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details