Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BGLAP2 Peptide - middle region

BGLAP2 Peptide - middle region

Product Specifications

Product Name Alternative

Bgp, Og2, BGP2, mOC-B, Bglap1

UniProt

P86547

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001027469.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSLLTLLALAALCLSDLTDAKPSGPESDKAFMSKQEGNKVVNRLRRYLGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PPL Polyclonal antibody
ARO-A14327-01 50 µg

Anti-PPL Polyclonal antibody

Sign In for Pricing
View Details
Anti-PPL Polyclonal antibody
ARO-A14327-02 100 µg

Anti-PPL Polyclonal antibody

Sign In for Pricing
View Details
Anti-PPL Polyclonal antibody
ARO-A14327-03 1 mg

Anti-PPL Polyclonal antibody

Sign In for Pricing
View Details
3-[ (Dimethylcarbamoyl) amino]benzoic acid
WKB16052-01 0.5 g

3-[ (Dimethylcarbamoyl) amino]benzoic acid

Sign In for Pricing
View Details
3-[ (Dimethylcarbamoyl) amino]benzoic acid
WKB16052-02 5 g

3-[ (Dimethylcarbamoyl) amino]benzoic acid

Sign In for Pricing
View Details
OR8B5P Protein Vector (Human) (pPB-C-His)
PV108846 500 ng

OR8B5P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details