Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BGLAP2 Peptide - middle region

BGLAP2 Peptide - middle region

Product Specifications

Product Name Alternative

Bgp, Og2, BGP2, mOC-B, Bglap1

UniProt

P86547

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001027469.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSLLTLLALAALCLSDLTDAKPSGPESDKAFMSKQEGNKVVNRLRRYLGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK2 Monoclonal Antibody(2C3)
MBS9417483-01 0.05 mL

MEK2 Monoclonal Antibody(2C3)

Sign In for Pricing
View Details
MEK2 Monoclonal Antibody(2C3)
MBS9417483-02 0.1 mL

MEK2 Monoclonal Antibody(2C3)

Sign In for Pricing
View Details
MEK2 Monoclonal Antibody(2C3)
MBS9417483-03 5x 0.1 mL

MEK2 Monoclonal Antibody(2C3)

Sign In for Pricing
View Details
LIN41 Polyclonal Antibody
MBS8531302-01 0.1 mg

LIN41 Polyclonal Antibody

Sign In for Pricing
View Details
LIN41 Polyclonal Antibody
MBS8531302-02 0.1 mL (AF635)

LIN41 Polyclonal Antibody

Sign In for Pricing
View Details
LIN41 Polyclonal Antibody
MBS8531302-03 0.1 mL (AF610)

LIN41 Polyclonal Antibody

Sign In for Pricing
View Details