Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD3B5 Peptide - middle region

HSD3B5 Peptide - middle region

Product Specifications

UniProt

Q61694

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032321.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL35AP32 3'UTR Luciferase Stable Cell Line
TU021450 1.0 mL

RPL35AP32 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-human Protein yippee-like 3 polyclonal Antibody, HRP conjugated
MBS1493097-01 0.05 mg

Rabbit anti-human Protein yippee-like 3 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Protein yippee-like 3 polyclonal Antibody, HRP conjugated
MBS1493097-02 0.1 mg

Rabbit anti-human Protein yippee-like 3 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Protein yippee-like 3 polyclonal Antibody, HRP conjugated
MBS1493097-03 5x 0.1 mg

Rabbit anti-human Protein yippee-like 3 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral human DNAJB8 shRNA (UAS) - Lentiviral human DNAJB8 shRNA (UAS, RFP) (100)
GTR15329691 1 Vial

Lentiviral human DNAJB8 shRNA (UAS) - Lentiviral human DNAJB8 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
3-benzylpyrrolidine
424041-01 25 mg

3-benzylpyrrolidine

Sign In for Pricing
View Details