Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD3B5 Peptide - middle region

HSD3B5 Peptide - middle region

Product Specifications

UniProt

Q61694

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032321.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Alpha-D-tocopherol (Alpha-D TPL) ELISA Kit
MBS7214097-01 48 Well

Canine Alpha-D-tocopherol (Alpha-D TPL) ELISA Kit

Sign In for Pricing
View Details
Canine Alpha-D-tocopherol (Alpha-D TPL) ELISA Kit
MBS7214097-02 96 Well

Canine Alpha-D-tocopherol (Alpha-D TPL) ELISA Kit

Sign In for Pricing
View Details
Canine Alpha-D-tocopherol (Alpha-D TPL) ELISA Kit
MBS7214097-03 5x 96 Well

Canine Alpha-D-tocopherol (Alpha-D TPL) ELISA Kit

Sign In for Pricing
View Details
Canine Alpha-D-tocopherol (Alpha-D TPL) ELISA Kit
MBS7214097-04 10x 96 Well

Canine Alpha-D-tocopherol (Alpha-D TPL) ELISA Kit

Sign In for Pricing
View Details
Kynurenine 3-monooxygenase
322023-01 50 µg

Kynurenine 3-monooxygenase

Sign In for Pricing
View Details
Kynurenine 3-monooxygenase
322023-02 100 µg

Kynurenine 3-monooxygenase

Sign In for Pricing
View Details