Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP3A16 Peptide - middle region

CYP3A16 Peptide - middle region

Product Specifications

UniProt

Q64481

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031846.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFKKFVDRMTENRLDSKQKHRVDFIYLMMEAYNKSKDKDSHKALSEIEIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIK3 Human Gene Knockout Kit (CRISPR)
KN223406LP 1 Kit

SIK3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MRP4 (ABCC4) (70-82) Goat Polyclonal Antibody
AP23671PU-N 100 µg

MRP4 (ABCC4) (70-82) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR562754 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
Porcine Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) ELISA Kit
RDR-TREM1-p-01 96 Tests

Porcine Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) ELISA Kit

Sign In for Pricing
View Details
Porcine Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) ELISA Kit
RDR-TREM1-p-02 48 Tests

Porcine Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) ELISA Kit

Sign In for Pricing
View Details
Dusp18 (NM_173745) Mouse Tagged ORF Clone
MG201769 10 µg

Dusp18 (NM_173745) Mouse Tagged ORF Clone

Sign In for Pricing
View Details