Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP3A16 Peptide - middle region

CYP3A16 Peptide - middle region

Product Specifications

UniProt

Q64481

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031846.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFKKFVDRMTENRLDSKQKHRVDFIYLMMEAYNKSKDKDSHKALSEIEIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2B3 Human Gene Knockout Kit (CRISPR)
KN424849 1 Kit

OR2B3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CRISP2 (NM_001142407) Human Over-expression Lysate
LY428074 100 µg

CRISP2 (NM_001142407) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705423 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Mouse NOV Antibody Pair Set
E-KAB-0705 50 µL & 100 µg

Mouse NOV Antibody Pair Set

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF488A conjugate, 0.1mg/mL
BNC880417-100 1x 100 µL

Fascin-1 (FSCN1/417), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glucose Transporter GLUT1 Recombinant Rabbit monoclonal Antibody
HA750002 100 µL

Glucose Transporter GLUT1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details