Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2-Q7 Peptide - middle region

H2-Q7 Peptide - middle region

Product Specifications

Product Name Alternative

Q9, Ped, Qa7, Qa-2, Qa-7, H-2Q7

UniProt

P14429

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034524.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERETQIAKGHEQSFRGSLRTAQSYYNQSKGGSHTLQWMYGCDMGSDGRLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NCR1/NKp46 Recombinant Rabbit monoclonal Antibody
HA725322B 100 µL

Human NCR1/NKp46 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HCK (Ab-410) Antibody
8B0938-AAT 50 µg

HCK (Ab-410) Antibody

Sign In for Pricing
View Details
Anti-Human IgG Antibody
KC-420-01 50 μL

Anti-Human IgG Antibody

Sign In for Pricing
View Details
Anti-Human IgG Antibody
KC-420-02 100 µL

Anti-Human IgG Antibody

Sign In for Pricing
View Details
Anti-Human IgG Antibody
KC-420-03 1 mL

Anti-Human IgG Antibody

Sign In for Pricing
View Details
Flotillin 1 (FLOT1) Human Gene Knockout Kit (CRISPR)
KN400231 1 Kit

Flotillin 1 (FLOT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details