Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2-Q7 Peptide - middle region

H2-Q7 Peptide - middle region

Product Specifications

Product Name Alternative

Q9, Ped, Qa7, Qa-2, Qa-7, H-2Q7

UniProt

P14429

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034524.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERETQIAKGHEQSFRGSLRTAQSYYNQSKGGSHTLQWMYGCDMGSDGRLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Entactin (NID1) (NM_002508) Human Over-expression Lysate
LC400896 20 µg

Entactin (NID1) (NM_002508) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human UGRP1 Protein
PKSH033201-01 10 µg

Recombinant Human UGRP1 Protein

Sign In for Pricing
View Details
Recombinant Human UGRP1 Protein
PKSH033201-02 50 µg

Recombinant Human UGRP1 Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS711728 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Dab1 (Ab-232) Antibody
8B7055-AAT 50 µg

Dab1 (Ab-232) Antibody

Sign In for Pricing
View Details
Heme Oxygenase 1 (HMOX1) Human Gene Knockout Kit (CRISPR)
KN200463LP 1 Kit

Heme Oxygenase 1 (HMOX1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details