Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HYPK Peptide - middle region

HYPK Peptide - middle region

Product Specifications

Product Name Alternative

HSPC136, 2310003F16Rik

UniProt

Q9CR41

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080594.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mammaglobin
CR387-1ml 1 mL

Mammaglobin

Sign In for Pricing
View Details
TGFA (Transforming Growth Factor alpha, TGF-alpha, TFGA, Pro-TGF-alpha, TGF-alpha) (MaxLight 650)
MBS6440441-01 0.1 mL

TGFA (Transforming Growth Factor alpha, TGF-alpha, TFGA, Pro-TGF-alpha, TGF-alpha) (MaxLight 650)

Sign In for Pricing
View Details
TGFA (Transforming Growth Factor alpha, TGF-alpha, TFGA, Pro-TGF-alpha, TGF-alpha) (MaxLight 650)
MBS6440441-02 5x 0.1 mL

TGFA (Transforming Growth Factor alpha, TGF-alpha, TFGA, Pro-TGF-alpha, TGF-alpha) (MaxLight 650)

Sign In for Pricing
View Details
Jagged1 (JAG1, AGS, AHD, AWS, HJ1, JAGL1, Alagille Syndrome Protein, CD339, Headturner, Htu, Serrate-1, Ser-1, Slalom) (Carboxyfluorescein)
J0400-01J 100 Tests

Jagged1 (JAG1, AGS, AHD, AWS, HJ1, JAGL1, Alagille Syndrome Protein, CD339, Headturner, Htu, Serrate-1, Ser-1, Slalom) (Carboxyfluorescein)

Sign In for Pricing
View Details
Mouse Syngr1 Pre-designed siRNA Set A
SI114137A 1 Each

Mouse Syngr1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
A3 glycan, procainamide labelled
HY-158531 1 Each

A3 glycan, procainamide labelled

Sign In for Pricing
View Details