Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HYPK Peptide - middle region

HYPK Peptide - middle region

Product Specifications

Product Name Alternative

HSPC136, 2310003F16Rik

UniProt

Q9CR41

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080594.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human BBS12 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 120UL
IRBAHUBBS12AAP93120UL 120 µL

Rabbit Anti Human BBS12 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 120UL

Sign In for Pricing
View Details
SLC39A5 Rabbit Polyclonal Antibody (BF405)
orb2465138 100 µL

SLC39A5 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Lentiviral human SMG7 sgRNA gene knockout kit - Lentiviral human SMG7 sgRNA gene knockout kit (100)
GTR15379375 1 Vial

Lentiviral human SMG7 sgRNA gene knockout kit - Lentiviral human SMG7 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
JNJ 10397049
IDB27558-01 1 mg

JNJ 10397049

Sign In for Pricing
View Details
JNJ 10397049
IDB27558-02 5 mg

JNJ 10397049

Sign In for Pricing
View Details
JNJ 10397049
IDB27558-03 10 mg

JNJ 10397049

Sign In for Pricing
View Details