MYDGF Peptide - middle region
MYDGF Peptide - middle region
Product Specifications
Product Name Alternative
Il25, Ly6elg, D17Wsu104e
UniProt
Q9CPT4
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_543027.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1387625 Inquire
Recombinant Bovine Xylosyltransferase 2 (XYLT2) , partial
Sign In for Pricing
View Details 
201-09-0222 96 Tests
Rabbit anti-thymocyte globulin (ATG) ELISA Kit
Sign In for Pricing
View Details 
ARP66110_P050-Biotin 100 µL
TACR2 Antibody - C-terminal region : Biotin (ARP66110_P050-Biotin)
Sign In for Pricing
View Details