What is the catalog number for MYDGF Peptide - middle region?

The catalog number for MYDGF Peptide - middle region is orb1998212.

What sizes are available for MYDGF Peptide - middle region?

MYDGF Peptide - middle region is available in the following size(s): 100 µg.

Is MYDGF Peptide - middle region in stock?

MYDGF Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MYDGF Peptide - middle region

Product Specifications

Product Name Alternative

Il25, Ly6elg, D17Wsu104e

UniProt

Q9CPT4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_543027.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K0529801 3x 1.0 µg

CTSL1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing

View Details

bs-12157R-PE 100 µL

PDGFAA + PDGFBB Polyclonal Antibody, PE Conjugated

Sign In for Pricing

View Details

NBP1-92683V 0.1 mL

Rabbit Polyclonal Adenylate Cyclase 3 Antibody [DyLight 405]

Sign In for Pricing

View Details

AAP54316-100UG 100 µg

APOA4 Peptide (AAP54316)

Sign In for Pricing

View Details

MBS5815753 Inquire

HLF1-11

Sign In for Pricing

View Details

NBP2-72368PEATT594 0.1 mL

Mouse Monoclonal BCAP/PIK3AP1 Antibody (OTI7A11) [PE/Atto594]

Sign In for Pricing

View Details