Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCU Peptide - C-terminal region

MCU Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm64, AV064928, C10orf42, Ccdc109a, 2010012O16Rik, D130073L02Rik

UniProt

Q3UMR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028431.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQV

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A1 antibody
70R-20365 50 ul

SLC7A1 antibody

Sign In for Pricing
View Details
PIM2 Antibody [L18N23]
F3887-100uL 100 µL

PIM2 Antibody [L18N23]

Sign In for Pricing
View Details
Met14 Antibody
orb854753 2 mg

Met14 Antibody

Sign In for Pricing
View Details
PRICKLE1 siRNA (Mouse)
MBS8221015-01 15 nmol

PRICKLE1 siRNA (Mouse)

Sign In for Pricing
View Details
PRICKLE1 siRNA (Mouse)
MBS8221015-02 30 nmol

PRICKLE1 siRNA (Mouse)

Sign In for Pricing
View Details
PRICKLE1 siRNA (Mouse)
MBS8221015-03 5x 30 nmol

PRICKLE1 siRNA (Mouse)

Sign In for Pricing
View Details