MCU Peptide - C-terminal region
MCU Peptide - C-terminal region
Product Specifications
Product Name Alternative
Gm64, AV064928, C10orf42, Ccdc109a, 2010012O16Rik, D130073L02Rik
UniProt
Q3UMR5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001028431.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQV
More Discoveries
Explore Other Products
Browse additional items from our catalog
220976-01 50 µL
B-Myb (Myb-Related Protein B, B Myb, Myb-like Protein 2, MYBL2, BMYB) discontinued
Sign In for Pricing
View Details 
220976-02 100 µL
B-Myb (Myb-Related Protein B, B Myb, Myb-like Protein 2, MYBL2, BMYB) discontinued
Sign In for Pricing
View Details 
