CEACAM10 Peptide - middle region
CEACAM10 Peptide - middle region
Product Specifications
Product Name Alternative
Bgp3, Cea10
UniProt
Q61400
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_031701.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AQVTVEAVPPNVTADNNVLLLVHNLPQTLRVFYWYKGNSGAGHNEIGRFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A01594-2-Dylight594 100 µg
Anti-Spermidine synthase/SRM Antibody Picoband®, Dylight594 Conjugate
Sign In for Pricing
View Details 
BOT1140 1 Each
Replacement DURAN GLS 80 Stirred Reactor Cap fits 500, 1000 and 2000mL GLS 80 bottles
Sign In for Pricing
View Details