CEACAM10 Peptide - middle region
CEACAM10 Peptide - middle region
Product Specifications
Product Name Alternative
Bgp3, Cea10
UniProt
Q61400
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_031701.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AQVTVEAVPPNVTADNNVLLLVHNLPQTLRVFYWYKGNSGAGHNEIGRFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-61256R-BF647-01 20 µL
ATP5MC1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details bsm-61256R-BF647-02 100 µL
ATP5MC1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details 
125553-AP 100 µL
CYLN2 (CAP-Gly Domain-containing Linker Protein 2, Cytoplasmic Linker Protein 115, CLIP-115, Cytoplasmic Linker Protein 2, Williams-Beuren Syndrome Chromosomal Region 3 Protein, Williams-Beuren Syndrome Chromosomal Region 4 Protein, CLIP2, KIAA0291, WBSCR3, WBSCR4, WSCR4) (AP) discontinued
Sign In for Pricing
View Details 
LV651716 1.0 µg DNA
CCL19 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details