Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT2A2 Peptide - middle region

UGT2A2 Peptide - middle region

Product Specifications

UniProt

Q6PDD0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019319.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLGSMVKNLTDEKANLIASALAQIPQKVLWRYKGKIPDTLGSNTRLFDWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RpsQ Antibody
orb827538 2 mg

RpsQ Antibody

Sign In for Pricing
View Details
2'-NH2-ATP
orb1690417 5 mg

2'-NH2-ATP

Sign In for Pricing
View Details
Anti-Phospho-eIF4E (Ser209) Rabbit Monoclonal Antibody
MA4391-.05 50 µL

Anti-Phospho-eIF4E (Ser209) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CDK2, Phosphorylated (Thr14) (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 405)
MBS6468505-01 0.1 mL

CDK2, Phosphorylated (Thr14) (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 405)

Sign In for Pricing
View Details
CDK2, Phosphorylated (Thr14) (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 405)
MBS6468505-02 5x 0.1 mL

CDK2, Phosphorylated (Thr14) (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 405)

Sign In for Pricing
View Details
Zebrafish Nap1l4b Rabbit Polyclonal Antibody (Fluoro594)
orb3088657 200 µL

Zebrafish Nap1l4b Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details