Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT2A2 Peptide - middle region

UGT2A2 Peptide - middle region

Product Specifications

UniProt

Q6PDD0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019319.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLGSMVKNLTDEKANLIASALAQIPQKVLWRYKGKIPDTLGSNTRLFDWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hk3 shRNA (UAS) - Lentiviral mouse Hk3 shRNA (UAS, RFP) (25)
GTR15277307 1 Vial

Lentiviral mouse Hk3 shRNA (UAS) - Lentiviral mouse Hk3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
BSG
308277-01 50 µL

BSG

Sign In for Pricing
View Details
BSG
308277-02 100 µL

BSG

Sign In for Pricing
View Details
Chicken Myelin Associated Glycoprotein ELISA Kit
MBS7205311-01 48 Well

Chicken Myelin Associated Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Chicken Myelin Associated Glycoprotein ELISA Kit
MBS7205311-02 96 Well

Chicken Myelin Associated Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Chicken Myelin Associated Glycoprotein ELISA Kit
MBS7205311-03 5x 96 Well

Chicken Myelin Associated Glycoprotein ELISA Kit

Sign In for Pricing
View Details