CYP2C70 Peptide - middle region
CYP2C70 Peptide - middle region
Product Specifications
UniProt
Q91W64
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_663474.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC200016L4 10 µg
C14orf166 (RTRAF) (NM_016039) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
585230-01 20 µg
Lymphocyte Antigen 6G, Recombinant, Mouse, aa4-96, His-Tag
Sign In for Pricing
View Details 585230-02 100 µg
Lymphocyte Antigen 6G, Recombinant, Mouse, aa4-96, His-Tag
Sign In for Pricing
View Details