Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2C70 Peptide - middle region

CYP2C70 Peptide - middle region

Product Specifications

UniProt

Q91W64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_663474.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAP2B Rabbit Polyclonal Antibody (BF647)
orb2445871 100 µL

RAP2B Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
HMG20A Antibody
orb1329897 100 µg

HMG20A Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) MLTF Polyclonal Antibody
MBS7151054 Inquire

Rabbit anti-Escherichia coli (strain K12) MLTF Polyclonal Antibody

Sign In for Pricing
View Details
TCF25 Antibody
E38QA6154 100 µL

TCF25 Antibody

Sign In for Pricing
View Details
WDR1 Rabbit pAb
E2510842 100 µL

WDR1 Rabbit pAb

Sign In for Pricing
View Details
HTATIP2 (CC3, TIP30, Oxidoreductase HTATIP2, 30kD HIV-1 TAT-interacting Protein, HIV-1 TAT-interactive Protein 2) (FITC)
MBS6147687-01 0.1 mL

HTATIP2 (CC3, TIP30, Oxidoreductase HTATIP2, 30kD HIV-1 TAT-interacting Protein, HIV-1 TAT-interactive Protein 2) (FITC)

Sign In for Pricing
View Details