Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES1E Peptide - C-terminal region

CES1E Peptide - C-terminal region

Product Specifications

Product Name Alternative

Eg, Es22, Es-22, egasyn

UniProt

Q64176

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598421.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGGTSEEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGC1 alpha (PPARGC1A) Human Gene Knockout Kit (CRISPR)
KN212244RB 1 Kit

PGC1 alpha (PPARGC1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Actin Regulatory Protein CAPG Antibody
KC-1177-01 50 μL

Actin Regulatory Protein CAPG Antibody

Sign In for Pricing
View Details
Actin Regulatory Protein CAPG Antibody
KC-1177-02 100 µL

Actin Regulatory Protein CAPG Antibody

Sign In for Pricing
View Details
Actin Regulatory Protein CAPG Antibody
KC-1177-03 1 mL

Actin Regulatory Protein CAPG Antibody

Sign In for Pricing
View Details
MAP3K15 (NM_001001671) Human Over-expression Lysate
LY400363 100 µg

MAP3K15 (NM_001001671) Human Over-expression Lysate

Sign In for Pricing
View Details
UNC5B Human Gene Knockout Kit (CRISPR)
KN218267BN 1 Kit

UNC5B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details