Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES1E Peptide - C-terminal region

CES1E Peptide - C-terminal region

Product Specifications

Product Name Alternative

Eg, Es22, Es-22, egasyn

UniProt

Q64176

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598421.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGGTSEEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS709281 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD19 (CVID3/155), CF640R conjugate, 0.1mg/mL
BNC400155-500 1x 500 µL

CD19 (CVID3/155), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD99 (NM_001122898) Human Recombinant Protein
TP720374L 500 µg

CD99 (NM_001122898) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant PTDSS2 Antibody
RC-5302-01 50 μL

Recombinant PTDSS2 Antibody

Sign In for Pricing
View Details
Recombinant PTDSS2 Antibody
RC-5302-02 100 µL

Recombinant PTDSS2 Antibody

Sign In for Pricing
View Details
Recombinant PTDSS2 Antibody
RC-5302-03 1 mL

Recombinant PTDSS2 Antibody

Sign In for Pricing
View Details